• Website Templates
    • Wordpress Store
      • WordPress Templates
      • WooCommerce Themes
      • Marketplace for Elementor
      • WordPress Maintenance
    • HTML Templates
      • HTML5 Site Templates
      • Landing Page Templates
      • Admin Templates
      • Newsletter Template
      • Specialty Pages
      • Muse Templates
    • Website Builders
      • TemplateMonster Sites
    • E-commerce Templates
      • Shopify Themes
      • Magento Themes
      • PrestaShop Themes
      • OpenCart Templates
      • VirtueMart Templates
      • ZenCart Templates
      • BigCommerce Themes
    • CMS Templates
      • Joomla Templates
      • Drupal Themes
    • Kits
      • Elementor Kits
    • Popular Categories
      • Software Company HTML Templates
      • Construction HTML Templates
      • Business Website Templates
      • Travel Website Templates
      • Business Wordpress Themes
      • Web Design Templates
      • Medical Wordpress Themes
      • News & Magazine WordPress Themes
      • Pet Shop Shopify Themes
      • Consulting HTML Templates
      • Consulting WordPress Themes
      • Advertising Agency Templates
      • Jewelry Shopify Themes
      • Software Company WordPress Themes
      • Auto Parts Shopify Themes
    • Website Categories
      • Art & Culture
      • Animals & Pets
      • Design & Photography
      • Education & Books
      • Business & Services
      • Cars & Motorcycles
      • Computers & Internet
      • Electronics Templates
      • Entertainment, Games & Nightlife
      • Home & Family
      • Fashion & Beauty
      • Food & Restaurant
      • Holidays, Gifts & Flowers
      • Medical Templates
      • Real Estate Templates
      • Society & People
      • Sports, Outdoors & Travel
  • WordPress Themes
  • Presentations
    • Presentations types
      • PowerPoint Templates
      • Google Slides Themes
      • Keynote Templates
      • Infographic Elements
    • Popular Categories
      • Design PowerPoint Templates
      • Consulting PowerPoint Templates
      • Web Design PowerPoint Templates
      • Art PowerPoint Templates
      • Business PowerPoint Templates
      • Fitness PowerPoint Templates
      • Design Studio PowerPoint Templates
      • Transportation PowerPoint Templates
      • Education Keynote Templates
      • Fashion Beauty PowerPoint Templates
      • Real Estate Keynote Templates
      • Food PowerPoint Templates
      • Architecture PowerPoint Templates
      • Lawyer PowerPoint Templates
      • Cars PowerPoint Templates
  • Graphics
    • Graphics
      • Illustrations
      • Fonts and Icon Fonts
      • Icon Sets
      • Patterns
      • Vectors
      • Backgrounds
      • Product Mockups
      • Google Sheets
    • Templates
      • Logo Templates
      • PSD Templates
      • Resume Templates
      • Certificate Templates
      • Magazine Templates
      • Planners
      • Corporate Identity
      • T-shirts
    • Web Elements
      • UI Elements
      • Animated Banners
      • Social Media
    • More
      • Unbounce Templates
      • Sketch Templates
      • App Templates
      • Bundles
      • Ebooks
  • Plugins
    • Plugins
      • WordPress Plugins
      • PrestaShop Modules
      • Joomla Extensions
      • Magento Extensions
      • JavaScript
      • Shopify Sections
  • 3D
    • 3D Graphics
      • 3D Models
  • Video
    • Video Templates
      • After Effects Templates
      • Premiere Pro Templates
      • Final Cut Pro Templates
      • Motion Graphics Templates
    • Stock Videos
      • Stock Video
  • Audio
    • Music
      • Stock Music
      • Sound Effects
  • Services
    • All Services
      • Web Design & Dev
      • Website Optimization
      • Graphic Design
      • Ads & Marketing
      • Content Writing
  • Recommended Hosting
  • Hire a Developer
ESES RURU DEDE PLPL ITIT TRTR FRFR BRBR NLNL CNCN CZCZ UAUA HUHU SESE
AI Website Builder
Website TemplatesWordPressShopifyHTMLWooCommerce PrestaShopJoomlaPowerPointMaintenance ServiceHire a Developer
Website Templates Landing Page Templates

10 And Landing Page Templates

Applied filter(s):
Tags: and × Clear
Sort by:
Trending Bestsellers Lowest Price Highest Price Top Rated Newest Products

Categories

Website Templates Landing Page Templates

Topics

Business & Services (1) Food & Restaurant (9)

MonsterONE Subscription

Tags

and (10) cafe (9) flavor (9) menu (9) restaurant (9) taste (9) food (8) dish (7) drink (7) gifts (7)

Color

white (9) grey (7) brown (6) black (5) green (5) blue (2) cyan (2) orange (2)

Features

Sliced PSD (10) HTML 5 (10) JQuery (10) Google map (9) HTML plus JS (9) Responsive (9) Parallax (5) On-line chat (4) One Page Templates (3) Dropdown Menu (2)

Gallery Script

Carousel (2) Accordion (1)

Styles

Neutral (10) Flat (10) Dark (1)
Italian Restaurant Responsive Landing Page Template

Italian Restaurant Responsive Landing Page Template

$11
Cafe and Restaurant Landing Page Template

Cafe and Restaurant Landing Page Template

$11
Build a Website in Minutes AI Website Builder
  • WordPress Management
  • Ecommerce Ready
  • Free Domain & Premium Hosting
  • Free SSL & Advanced Security
  • SEO Optimized & 90+ PageSpeed Score
  • Fully Responsive & Mobile-Ready
Start building
Italian Restaurant Responsive Landing Page Template

Italian Restaurant Responsive Landing Page Template

$11
Gas & Oil Responsive Landing Page Template

Gas & Oil Responsive Landing Page Template

$11
Italian Restaurant Responsive Landing Page Template

Italian Restaurant Responsive Landing Page Template

$11
Cafe and Restaurant Responsive Landing Page Template

Cafe and Restaurant Responsive Landing Page Template

$11
Cafe and Restaurant Responsive Landing Page Template

Cafe and Restaurant Responsive Landing Page Template

$11
Cafe and Restaurant Responsive Landing Page Template

Cafe and Restaurant Responsive Landing Page Template

$11
Cafe and Restaurant Responsive Landing Page Template

Cafe and Restaurant Responsive Landing Page Template

$11
Cafe and Restaurant Responsive Landing Page Template

Cafe and Restaurant Responsive Landing Page Template

$11

5 Best And Landing Page Templates 2026

Template Name Downloads Price
Italian Restaurant Responsive Landing Page Template 55 $11
Cafe and Restaurant Landing Page Template 18 $11
Italian Restaurant Responsive Landing Page Template 28 $11
Gas & Oil Responsive Landing Page Template 59 $11
Italian Restaurant Responsive Landing Page Template 37 $11

Popular tags:

companytechnicalfinancialservicebusinessspecialdevelopmentcenterequipmentprofessionalrecipetastecssplasticphotographermanufacturelearningtreatmenttherapyconsultation

TemplateMonster is a marketplace where you can buy everything you need to create a website. Hundreds of independent developers sell their products here so that you could create your own unique project.

InstagramFacebookYouTubeTwitterPinterestTikTok

Products

WordPress ThemesWooCommerce ThemesHTML5 TemplatesShopify ThemesZemezMotoCMSWebliumMotoPressMonsterONENovi Builder

Topics

Business & ServicesFashion & BeautyHome & FamilyDesign & PhotographyReal EstateCars & MotorcyclesMedicalSports, Outdoors & TravelFood & RestaurantElectronics

Company

About UsLicensesBlogPromocodes/CouponsBest Website HostingService CenterPartners' Coupon CodesContact UsGift CardMonster's AwardBrand IdentityTop Authors

Support

Help CenterReport SpamSitemapRefund PolicyPrivacy PolicyTerms of UseAI Website Builder Terms of Service

© 2026 TemplateMonster.com. Jetimpex Inc. All rights reserved.

Last time updated 2026-07-22T10:29:23-04:00