• Website Templates
    • Wordpress Store
      • WordPress Templates
      • WooCommerce Themes
      • Marketplace for Elementor
      • WordPress Maintenance
    • HTML Templates
      • HTML5 Site Templates
      • Landing Page Templates
      • Admin Templates
      • Newsletter Template
      • Specialty Pages
      • Muse Templates
    • Website Builders
      • TemplateMonster Sites
    • E-commerce Templates
      • Shopify Themes
      • Magento Themes
      • PrestaShop Themes
      • OpenCart Templates
      • VirtueMart Templates
      • ZenCart Templates
      • BigCommerce Themes
    • CMS Templates
      • Joomla Templates
      • Drupal Themes
    • Kits
      • Elementor Kits
    • Popular Categories
      • Software Company HTML Templates
      • Construction HTML Templates
      • Business Website Templates
      • Travel Website Templates
      • Business Wordpress Themes
      • Web Design Templates
      • Medical Wordpress Themes
      • News & Magazine WordPress Themes
      • Pet Shop Shopify Themes
      • Consulting HTML Templates
      • Consulting WordPress Themes
      • Advertising Agency Templates
      • Jewelry Shopify Themes
      • Software Company WordPress Themes
      • Auto Parts Shopify Themes
    • Website Categories
      • Art & Culture
      • Animals & Pets
      • Design & Photography
      • Education & Books
      • Business & Services
      • Cars & Motorcycles
      • Computers & Internet
      • Electronics Templates
      • Entertainment, Games & Nightlife
      • Home & Family
      • Fashion & Beauty
      • Food & Restaurant
      • Holidays, Gifts & Flowers
      • Medical Templates
      • Real Estate Templates
      • Society & People
      • Sports, Outdoors & Travel
  • WordPress Themes
  • Presentations
    • Presentations types
      • PowerPoint Templates
      • Google Slides Themes
      • Keynote Templates
      • Infographic Elements
    • Popular Categories
      • Design PowerPoint Templates
      • Consulting PowerPoint Templates
      • Web Design PowerPoint Templates
      • Art PowerPoint Templates
      • Business PowerPoint Templates
      • Fitness PowerPoint Templates
      • Design Studio PowerPoint Templates
      • Transportation PowerPoint Templates
      • Education Keynote Templates
      • Fashion Beauty PowerPoint Templates
      • Real Estate Keynote Templates
      • Food PowerPoint Templates
      • Architecture PowerPoint Templates
      • Lawyer PowerPoint Templates
      • Cars PowerPoint Templates
  • Graphics
    • Graphics
      • Illustrations
      • Fonts and Icon Fonts
      • Icon Sets
      • Patterns
      • Vectors
      • Backgrounds
      • Product Mockups
      • Google Sheets
    • Templates
      • Logo Templates
      • PSD Templates
      • Resume Templates
      • Certificate Templates
      • Magazine Templates
      • Planners
      • Corporate Identity
      • T-shirts
    • Web Elements
      • UI Elements
      • Animated Banners
      • Social Media
    • More
      • Unbounce Templates
      • Sketch Templates
      • App Templates
      • Bundles
      • Ebooks
  • Plugins
    • Plugins
      • WordPress Plugins
      • PrestaShop Modules
      • Joomla Extensions
      • Magento Extensions
      • JavaScript
      • Shopify Sections
  • 3D
    • 3D Graphics
      • 3D Models
  • Video
    • Video Templates
      • After Effects Templates
      • Premiere Pro Templates
      • Final Cut Pro Templates
      • Motion Graphics Templates
    • Stock Videos
      • Stock Video
  • Audio
    • Music
      • Stock Music
      • Sound Effects
  • Services
    • All Services
      • Web Design & Dev
      • Website Optimization
      • Graphic Design
      • Ads & Marketing
      • Content Writing
  • Recommended Hosting
  • Hire a Developer
ESES RURU DEDE PLPL ITIT TRTR FRFR BRBR NLNL CNCN CZCZ UAUA HUHU SESE
AI Website Builder
Website TemplatesWordPressShopifyHTMLWooCommerce PrestaShopJoomlaPowerPointMaintenance ServiceHire a Developer
Website Templates WooCommerce Themes

43 Cosmetics WooCommerce Themes

Applied filter(s):
Tags: cosmetics × Clear
Sort by:
Trending Bestsellers Lowest Price Highest Price Top Rated Newest Products

Categories

Website Templates WooCommerce Themes

Topics

Medical Templates (8) Design & Photography (2) Business & Services (2) Art & Culture (3) Electronics Templates (3) Home & Family (4) Fashion & Beauty (41) Holidays, Gifts & Flowers (1) Society & People (3) Computers & Internet (1) Food & Restaurant (1) Sports, Outdoors & Travel (3)

On Sale (Yes)

MonsterONE Subscription

Tags

cosmetics (43) beauty (35) fashion (31) shop (27) responsive (25) woocommerce (24) accessories (23) cosmetic (22) multipurpose (19) ecommerce (18)

WordPress Builder

Elementor Website Builder (37) WPBakery Page Builder (2) WordPress Customizer API (2) Gutenberg Editor (1) Visual Composer (1) Custom (1)

Color

white (32) grey (17) black (12) green (7) cyan (6) pink (2) yellow (2) orange (2) brown (1) blue (1)

Features

Responsive (43) Dropdown Menu (38) Admin Panel (37) Search Engine Friendly (36) Website Builder (36) Sample content (35) Blog (34) Performance Optimization (32) Advanced Theme Options (31) Online Store/Shop (31)

WordPress Compatibility

7.0.x (3) 6.9.x (14) 6.8.x (23) 6.7.x (25) 6.6.x (24) 6.5.x (25) 6.4.x (26) 6.3.x (27) 6.2.x (26) 6.1.x (25)

WooCommerce Compatibility

9.9.x (16) 9.8.x (18) 9.7.x (21) 9.6.x (21) 9.5.x (21) 9.4.x (21) 9.3.x (21) 9.2.x (20) 9.1.x (20) 9.0.x (20)

Compatible with

MailChimp (38) WPML (37) WooCommerce (34) Revolution Slider (22) Polylang (18) Ecwid (14) LearnPress (1)

WordPress.com Compatibility (WordPress.com Business Plan)

Styles

Clean (22) Minimalist (20) Flat (19) Neutral (18) Mobile (17) Corporate (12) Dark (12) Futurist (12) Web2.0 (11) Collage (8)

Updated (in last 6 months)

Organica - Organic Food, Cosmetics and Bio Active Nutrition WooCommerce Theme

Organica - Organic Food, Cosmetics and Bio Active Nutrition WooCommerce Theme

$61
UpStar - Multipurpose Store Elementor WooCommerce Theme

UpStar - Multipurpose Store Elementor WooCommerce Theme

$79
Build a Website in Minutes AI Website Builder
  • WordPress Management
  • Ecommerce Ready
  • Free Domain & Premium Hosting
  • Free SSL & Advanced Security
  • SEO Optimized & 90+ PageSpeed Score
  • Fully Responsive & Mobile-Ready
Start building
Perfumy - Perfumes, Deos and Fragrances WooCommerce Elementor Responsive Theme

Perfumy - Perfumes, Deos and Fragrances WooCommerce Elementor Responsive Theme

$69
MediCort - Medical ECommerce Classic Elementor WooCommerce Theme

MediCort - Medical ECommerce Classic Elementor WooCommerce Theme

$61
Artcraft - Handmade ECommerce Clean Elementor WooCommerce Theme

Artcraft - Handmade ECommerce Clean Elementor WooCommerce Theme

$61
Fragrancia Perfume Store WooCommerce Theme

Fragrancia Perfume Store WooCommerce Theme

$51
Arts-n-crafts - Handmade Art Elementor

Arts-n-crafts - Handmade Art Elementor

$51
Tm Francy WooCommerce Theme

Tm Francy WooCommerce Theme

$51
Cosmeli -  Cosmetics & Beauty for WordPress. WooCommerce Theme

Cosmeli - Cosmetics & Beauty for WordPress. WooCommerce Theme

$32
Paletto - Cosmetic Store Elementor WooCommerce Theme

Paletto - Cosmetic Store Elementor WooCommerce Theme

$61
Perfume - Cosmetics & Perfumes Store WooCommerce WordPress Theme

Perfume - Cosmetics & Perfumes Store WooCommerce WordPress Theme

$48
Bellacos - Beauty & Cosmetics WooCommerce WordPress Theme SALE

Bellacos - Beauty & Cosmetics WooCommerce WordPress Theme

$101
$81
Bellas - Mordern Beauty Salon and Cosmetic Store Woocommerce WordPress Theme Elementor Ready

Bellas - Mordern Beauty Salon and Cosmetic Store Woocommerce WordPress Theme Elementor Ready

$61
Perfume FSE - Perfume Store, Perfume Shop WooCommerce Theme

Perfume FSE - Perfume Store, Perfume Shop WooCommerce Theme

$67
Opaline - Beauty Salon & Spa Service Woocommerce Theme

Opaline - Beauty Salon & Spa Service Woocommerce Theme

$71
SerumX - Cosmetic Serum Shop & Beauty Products WooCommerce Elementor Theme

SerumX - Cosmetic Serum Shop & Beauty Products WooCommerce Elementor Theme

$51
Flaunt Beauty - Beauty, Skin Care, and Cosmetics WooCommerce Elementor Template SALE

Flaunt Beauty - Beauty, Skin Care, and Cosmetics WooCommerce Elementor Template

$46
$37
Pure Glow - Beauty & Skin Care Shop WooCommerce Elementor Template

Pure Glow - Beauty & Skin Care Shop WooCommerce Elementor Template

$46
Wearon – Fashion Store and Beauty Multipurpose Mega WooCommerce Theme

Wearon – Fashion Store and Beauty Multipurpose Mega WooCommerce Theme

$69
Glamar - Cosmetics, Skin Care and Beauty Products Elementor WooCommerce Theme

Glamar - Cosmetics, Skin Care and Beauty Products Elementor WooCommerce Theme

$69
Fragrance - Perfume Store & Cosmetic WooCommerce Elementor Theme

Fragrance - Perfume Store & Cosmetic WooCommerce Elementor Theme

$41
Purfemos - Perfumes, Fashion and Cosmetics Store WooCommerce Theme

Purfemos - Perfumes, Fashion and Cosmetics Store WooCommerce Theme

$71
Purs -  Purse and Handbags and Leather Bag Store WooCommerce WordPress Theme

Purs - Purse and Handbags and Leather Bag Store WooCommerce WordPress Theme

$71
Glamour - Skincare, Beauty and Cosmetic WooCommerce Elementor Responsive Theme

Glamour - Skincare, Beauty and Cosmetic WooCommerce Elementor Responsive Theme

$69
Styles - Fashion and Style WooCommerce Elementor

Styles - Fashion and Style WooCommerce Elementor

$71
Stelina - Perfume Store WooCommerce Theme

Stelina - Perfume Store WooCommerce Theme

$59
Beautice - Beauty & Cosmetics WooCommerce Theme

Beautice - Beauty & Cosmetics WooCommerce Theme

$51
Jewereld - Jewelry Fashion Store Elementor WooCommerce Responsive Theme

Jewereld - Jewelry Fashion Store Elementor WooCommerce Responsive Theme

$71
Sophie - The Best of Skincare, Beauty and Cosmetic WooCommerce Elementor Responsive Theme

Sophie - The Best of Skincare, Beauty and Cosmetic WooCommerce Elementor Responsive Theme

$69
Nexaspa - Spa, Cosmetic and Beauty WooCommerce Theme

Nexaspa - Spa, Cosmetic and Beauty WooCommerce Theme

$69
Fizzi - Natural Cosmetics Website Template WooCommerce Theme

Fizzi - Natural Cosmetics Website Template WooCommerce Theme

$61
Time Watch Store Elementor WooCommerce Responsive Theme

Time Watch Store Elementor WooCommerce Responsive Theme

$71
Beauty - Beauty & Cosmetics WooCommerce Theme

Beauty - Beauty & Cosmetics WooCommerce Theme

$108
Vigils - Smart Wearable & Digital Watch Store Elementor WooCommerce Responsive Theme

Vigils - Smart Wearable & Digital Watch Store Elementor WooCommerce Responsive Theme

$71
Mania - Online Fashion Store Elementor WooCommerce Responsive Theme

Mania - Online Fashion Store Elementor WooCommerce Responsive Theme

$71
Craftekko - Handmade ECommerce Clean Elementor WooCommerce Theme

Craftekko - Handmade ECommerce Clean Elementor WooCommerce Theme

$61
  • «
  • 1
  • 2
  • »

Popular tags:

shoeswoocommerceonlineminimalmodernbuilderpricescompanyhairstylebagsarrivalsmedicinemarketpartsteamreviewst shirtanimalspharmacy

TemplateMonster is a marketplace where you can buy everything you need to create a website. Hundreds of independent developers sell their products here so that you could create your own unique project.

InstagramFacebookYouTubeTwitterPinterestTikTok

Products

WordPress ThemesWooCommerce ThemesHTML5 TemplatesShopify ThemesZemezMotoCMSWebliumMotoPressMonsterONENovi Builder

Topics

Business & ServicesFashion & BeautyHome & FamilyDesign & PhotographyReal EstateCars & MotorcyclesMedicalSports, Outdoors & TravelFood & RestaurantElectronics

Company

About UsLicensesBlogPromocodes/CouponsBest Website HostingService CenterPartners' Coupon CodesContact UsGift CardMonster's AwardBrand IdentityTop Authors

Support

Help CenterReport SpamSitemapRefund PolicyPrivacy PolicyTerms of UseAI Website Builder Terms of Service

© 2026 TemplateMonster.com. Jetimpex Inc. All rights reserved.

Last time updated 2026-07-15T03:38:32-04:00