• Website Templates
    • Wordpress Store
      • WordPress Templates
      • WooCommerce Themes
      • Marketplace for Elementor
      • WordPress Maintenance
    • HTML Templates
      • HTML5 Site Templates
      • Landing Page Templates
      • Admin Templates
      • Newsletter Template
      • Specialty Pages
      • Muse Templates
    • Website Builders
      • TemplateMonster Sites
    • E-commerce Templates
      • Shopify Themes
      • Magento Themes
      • PrestaShop Themes
      • OpenCart Templates
      • VirtueMart Templates
      • ZenCart Templates
      • BigCommerce Themes
    • CMS Templates
      • Joomla Templates
      • Drupal Themes
    • Kits
      • Elementor Kits
    • Popular Categories
      • Software Company HTML Templates
      • Construction HTML Templates
      • Business Website Templates
      • Travel Website Templates
      • Business Wordpress Themes
      • Web Design Templates
      • Medical Wordpress Themes
      • News & Magazine WordPress Themes
      • Pet Shop Shopify Themes
      • Consulting HTML Templates
      • Consulting WordPress Themes
      • Advertising Agency Templates
      • Jewelry Shopify Themes
      • Software Company WordPress Themes
      • Auto Parts Shopify Themes
    • Website Categories
      • Art & Culture
      • Animals & Pets
      • Design & Photography
      • Education & Books
      • Business & Services
      • Cars & Motorcycles
      • Computers & Internet
      • Electronics Templates
      • Entertainment, Games & Nightlife
      • Home & Family
      • Fashion & Beauty
      • Food & Restaurant
      • Holidays, Gifts & Flowers
      • Medical Templates
      • Real Estate Templates
      • Society & People
      • Sports, Outdoors & Travel
  • WordPress Themes
  • Presentations
    • Presentations types
      • PowerPoint Templates
      • Google Slides Themes
      • Keynote Templates
      • Infographic Elements
    • Popular Categories
      • Design PowerPoint Templates
      • Consulting PowerPoint Templates
      • Web Design PowerPoint Templates
      • Art PowerPoint Templates
      • Business PowerPoint Templates
      • Fitness PowerPoint Templates
      • Design Studio PowerPoint Templates
      • Transportation PowerPoint Templates
      • Education Keynote Templates
      • Fashion Beauty PowerPoint Templates
      • Real Estate Keynote Templates
      • Food PowerPoint Templates
      • Architecture PowerPoint Templates
      • Lawyer PowerPoint Templates
      • Cars PowerPoint Templates
  • Graphics
    • Graphics
      • Illustrations
      • Fonts and Icon Fonts
      • Icon Sets
      • Patterns
      • Vectors
      • Backgrounds
      • Product Mockups
      • Google Sheets
    • Templates
      • Logo Templates
      • PSD Templates
      • Resume Templates
      • Certificate Templates
      • Magazine Templates
      • Planners
      • Corporate Identity
      • T-shirts
    • Web Elements
      • UI Elements
      • Animated Banners
      • Social Media
    • More
      • Unbounce Templates
      • Sketch Templates
      • App Templates
      • Bundles
      • Ebooks
  • Plugins
    • Plugins
      • WordPress Plugins
      • PrestaShop Modules
      • Joomla Extensions
      • Magento Extensions
      • JavaScript
      • Shopify Sections
  • 3D
    • 3D Graphics
      • 3D Models
  • Video
    • Video Templates
      • After Effects Templates
      • Premiere Pro Templates
      • Final Cut Pro Templates
      • Motion Graphics Templates
    • Stock Videos
      • Stock Video
  • Audio
    • Music
      • Stock Music
      • Sound Effects
  • Services
    • All Services
      • Web Design & Dev
      • Website Optimization
      • Graphic Design
      • Ads & Marketing
      • Content Writing
  • Recommended Hosting
  • Hire a Developer
ESES RURU DEDE PLPL ITIT TRTR FRFR BRBR NLNL CNCN CZCZ UAUA HUHU SESE
AI Website Builder
Website TemplatesWordPressShopifyHTMLWooCommerce PrestaShopJoomlaPowerPointMaintenance ServiceHire a Developer
Website Templates WooCommerce Themes

8 Prices WooCommerce Themes

Applied filter(s):
Tags: prices × Clear
Sort by:
Trending Bestsellers Lowest Price Highest Price Top Rated Newest Products

Categories

Website Templates WooCommerce Themes

Topics

Design & Photography (2) Art & Culture (2) Fashion & Beauty (1) Food & Restaurant (2) Sports, Outdoors & Travel (1)

MonsterONE Subscription

Tags

prices (8) shopping (5) store (5) cart (4) online (3) shop (3) accessory (2) art (2) bag (2) bank (2)

WordPress Builder

Cherry Framework 3 (5) Elementor Website Builder (1) Cherry Framework 5 (1)

Color

white (7) black (6) grey (6) green (3) orange (3) brown (2) red (2) blue (1)

Features

Google map (8) Advanced Theme Options (8) Blog (8) Online Store/Shop (8) Admin Panel (8) Search Engine Friendly (8) Responsive (8) Dropdown Menu (7) Tabs (7) HTML 5 (7)

WordPress Compatibility

5.6.x (1) 4.9.x (7)

WooCommerce Compatibility

4.2.x (1) 3.0.x (1) 2.4.x (5)

Compatible with

Ecwid (8) WPML (8) MailChimp (2) WooCommerce (1)

Styles

Neutral (8) Flat (6)
Business Cards - Card Design Store WooCommerce Theme

Business Cards - Card Design Store WooCommerce Theme

$61
Coffee Shop WooCommerce Theme

Coffee Shop WooCommerce Theme

$51
Build a Website in Minutes AI Website Builder
  • WordPress Management
  • Ecommerce Ready
  • Free Domain & Premium Hosting
  • Free SSL & Advanced Security
  • SEO Optimized & 90+ PageSpeed Score
  • Fully Responsive & Mobile-Ready
Start building
Gameedion WooCommerce Theme

Gameedion WooCommerce Theme

$51
Extremex WooCommerce Theme

Extremex WooCommerce Theme

$51
Photo Stock WooCommerce Theme

Photo Stock WooCommerce Theme

$51
Photo and Video WooCommerce Theme

Photo and Video WooCommerce Theme

$51
Caviar Online Store WooCommerce Theme

Caviar Online Store WooCommerce Theme

$51
Responsive Clothes Store WooCommerce Theme

Responsive Clothes Store WooCommerce Theme

$51

5 Best Prices WooCommerce Themes 2026

Template Name Downloads Price
Business Cards - Card Design Store WooCommerce Theme 22 $61
Coffee Shop WooCommerce Theme 78 $51
Gameedion WooCommerce Theme 31 $51
Extremex WooCommerce Theme 6 $51
Photo Stock WooCommerce Theme 15 $51

Popular tags:

onlinecosmeticproductsthememodernwebsitetemplategiftbusinessofferhtmlchildrenrepairmarketsystemgameteaperfumesweightfree

TemplateMonster is a marketplace where you can buy everything you need to create a website. Hundreds of independent developers sell their products here so that you could create your own unique project.

InstagramFacebookYouTubeTwitterPinterestTikTok

Products

WordPress ThemesWooCommerce ThemesHTML5 TemplatesShopify ThemesZemezMotoCMSWebliumMotoPressMonsterONENovi Builder

Topics

Business & ServicesFashion & BeautyHome & FamilyDesign & PhotographyReal EstateCars & MotorcyclesMedicalSports, Outdoors & TravelFood & RestaurantElectronics

Company

About UsLicensesBlogPromocodes/CouponsBest Website HostingService CenterPartners' Coupon CodesContact UsGift CardMonster's AwardBrand IdentityTop Authors

Support

Help CenterReport SpamSitemapRefund PolicyPrivacy PolicyTerms of UseAI Website Builder Terms of Service

© 2026 TemplateMonster.com. Jetimpex Inc. All rights reserved.

Last time updated 2026-06-17T08:07:34-04:00