• Website Templates
    • Wordpress Store
      • WordPress Templates
      • WooCommerce Themes
      • Marketplace for Elementor
      • WordPress Maintenance
    • HTML Templates
      • HTML5 Site Templates
      • Landing Page Templates
      • Admin Templates
      • Newsletter Template
      • Specialty Pages
      • Muse Templates
    • Website Builders
      • TemplateMonster Sites
    • E-commerce Templates
      • Shopify Themes
      • Magento Themes
      • PrestaShop Themes
      • OpenCart Templates
      • VirtueMart Templates
      • ZenCart Templates
      • BigCommerce Themes
    • CMS Templates
      • Joomla Templates
      • Drupal Themes
    • Kits
      • Elementor Kits
    • Popular Categories
      • Software Company HTML Templates
      • Construction HTML Templates
      • Business Website Templates
      • Travel Website Templates
      • Business Wordpress Themes
      • Web Design Templates
      • Medical Wordpress Themes
      • News & Magazine WordPress Themes
      • Pet Shop Shopify Themes
      • Consulting HTML Templates
      • Consulting WordPress Themes
      • Advertising Agency Templates
      • Jewelry Shopify Themes
      • Software Company WordPress Themes
      • Auto Parts Shopify Themes
    • Website Categories
      • Art & Culture
      • Animals & Pets
      • Design & Photography
      • Education & Books
      • Business & Services
      • Cars & Motorcycles
      • Computers & Internet
      • Electronics Templates
      • Entertainment, Games & Nightlife
      • Home & Family
      • Fashion & Beauty
      • Food & Restaurant
      • Holidays, Gifts & Flowers
      • Medical Templates
      • Real Estate Templates
      • Society & People
      • Sports, Outdoors & Travel
  • WordPress Themes
  • Presentations
    • Presentations types
      • PowerPoint Templates
      • Google Slides Themes
      • Keynote Templates
      • Infographic Elements
    • Popular Categories
      • Design PowerPoint Templates
      • Consulting PowerPoint Templates
      • Web Design PowerPoint Templates
      • Art PowerPoint Templates
      • Business PowerPoint Templates
      • Fitness PowerPoint Templates
      • Design Studio PowerPoint Templates
      • Transportation PowerPoint Templates
      • Education Keynote Templates
      • Fashion Beauty PowerPoint Templates
      • Real Estate Keynote Templates
      • Food PowerPoint Templates
      • Architecture PowerPoint Templates
      • Lawyer PowerPoint Templates
      • Cars PowerPoint Templates
  • Graphics
    • Graphics
      • Illustrations
      • Fonts and Icon Fonts
      • Icon Sets
      • Patterns
      • Vectors
      • Backgrounds
      • Product Mockups
      • Google Sheets
    • Templates
      • Logo Templates
      • PSD Templates
      • Resume Templates
      • Certificate Templates
      • Magazine Templates
      • Planners
      • Corporate Identity
      • T-shirts
    • Web Elements
      • UI Elements
      • Animated Banners
      • Social Media
    • More
      • Unbounce Templates
      • Sketch Templates
      • App Templates
      • Bundles
      • Ebooks
  • Plugins
    • Plugins
      • WordPress Plugins
      • PrestaShop Modules
      • Joomla Extensions
      • Magento Extensions
      • JavaScript
      • Shopify Sections
  • 3D
    • 3D Graphics
      • 3D Models
  • Video
    • Video Templates
      • After Effects Templates
      • Premiere Pro Templates
      • Final Cut Pro Templates
      • Motion Graphics Templates
    • Stock Videos
      • Stock Video
  • Audio
    • Music
      • Stock Music
      • Sound Effects
  • Services
    • All Services
      • Web Design & Dev
      • Website Optimization
      • Graphic Design
      • Ads & Marketing
      • Content Writing
  • Recommended Hosting
  • Hire a Developer
ESES RURU DEDE PLPL ITIT TRTR FRFR BRBR NLNL CNCN CZCZ UAUA HUHU SESE
Log In to AI Builder
Website TemplatesWordPressShopifyHTMLWooCommerce PrestaShopJoomlaPowerPointMaintenance ServiceHire a Developer
Graphics Logo Templates

30 Bond Logo Templates

Applied filter(s):
Tags: bond × Clear
Sort by:
Trending Bestsellers Lowest Price Highest Price Top Rated Newest Products

Categories

Graphics Logo Templates

Topics

Business & Services (2) Animals & Pets (1) Art & Culture (1) Computers & Internet (2)

MonsterONE Subscription

AI-generated (Created with AI)

Tags

bond (30) design (21) logo (21) template (21) connection (16) link (14) abstract (13) synergy (10) technology (10) cooperation (9)

Color

white (26) black (4) grey (2) brown (1) green (1) yellow (1) orange (1)

Graphics Type

Vector (7) Raster (1)

Compatibility

Adobe Illustrator (7) Adobe Photoshop (5) Corel Draw (2)

Files Included

JPEG (6) EPS (6) AI (6) PSD (4) PNG (4) PDF (3) JPG (2) SVG (1) CDR (1)

Updated (in last 6 months)

This Is peace logo Templates

This Is peace logo Templates

$22
Brand Tech - Letter B Logo

Brand Tech - Letter B Logo

$31
Build a Website in Minutes AI Website Builder
  • WordPress Management
  • Ecommerce Ready
  • Free Domain & Premium Hosting
  • Free SSL & Advanced Security
  • SEO Optimized & 90+ PageSpeed Score
  • Fully Responsive & Mobile-Ready
Start building
Business Circle Logo Design Template

Business Circle Logo Design Template

$19
Express Documents Logo Template

Express Documents Logo Template

$12
Graphics Data Analytic Logo Template

Graphics Data Analytic Logo Template

$25
Love Family Logo Template

Love Family Logo Template

$25
Tiger Family Logo Template

Tiger Family Logo Template

$37
Maternal Love Logo Template

Maternal Love Logo Template

$37
Nexus Chain Knot Logo Template

Nexus Chain Knot Logo Template

$37
Gear Geek Logo Template

Gear Geek Logo Template

$25
Shared Hearts Logo Template

Shared Hearts Logo Template

$37
S Natural Symbiosis Logo Template

S Natural Symbiosis Logo Template

$37
Chain Circle Logo Template

Chain Circle Logo Template

$37
W Triangle Node Logo Template

W Triangle Node Logo Template

$37
Triquetra Alliance Logo Template

Triquetra Alliance Logo Template

$37
Triquetra Trinity Knot Logo Template

Triquetra Trinity Knot Logo Template

$37
Triangle of Infinity Logo Template

Triangle of Infinity Logo Template

$37
Interlaced Cubes Logo Template

Interlaced Cubes Logo Template

$37
Cat and Dog Friendship Logo Template

Cat and Dog Friendship Logo Template

$37
Interlaced Cogwheels Logo Template

Interlaced Cogwheels Logo Template

$37
S Square Connection Logo Template

S Square Connection Logo Template

$37
Infinity Leaves Logo Template

Infinity Leaves Logo Template

$37
CS Abstract Link Logo Template

CS Abstract Link Logo Template

$37
S Interlaced Squares Logo Template

S Interlaced Squares Logo Template

$37
Yoga and Spa Transformation Logo Template

Yoga and Spa Transformation Logo Template

$37
Natural Symbiosis Logo Template

Natural Symbiosis Logo Template

$37
Synergy of Hearts Logo Template

Synergy of Hearts Logo Template

$37
Privatis Logo or Letter C Logo or Letter Logo

Privatis Logo or Letter C Logo or Letter Logo

$33
Webbing Bond Gradient Colorful Logo

Webbing Bond Gradient Colorful Logo

$22
Minimalist Pet Animal Vector Illustration

Minimalist Pet Animal Vector Illustration

$10

5 Best Bond Logo Templates 2026

Template Name Downloads Price
This Is peace logo Templates 0 $22
Brand Tech - Letter B Logo 0 $31
Business Circle Logo Design Template 0 $19
Express Documents Logo Template 0 $12
Graphics Data Analytic Logo Template 0 $25

Popular tags:

elegantcliniclogotypelogomultimediasmartcomposeminimalistroyalpharmacyclassysharefindkingdomrainbowpicturehelixdatabaseosteopathyserver

TemplateMonster is a marketplace where you can buy everything you need to create a website. Hundreds of independent developers sell their products here so that you could create your own unique project.

InstagramFacebookYouTubeTwitterPinterestTikTok

Products

WordPress ThemesWooCommerce ThemesHTML5 TemplatesShopify ThemesZemezMotoCMSWebliumMotoPressMonsterONENovi Builder

Topics

Business & ServicesFashion & BeautyHome & FamilyDesign & PhotographyReal EstateCars & MotorcyclesMedicalSports, Outdoors & TravelFood & RestaurantElectronics

Company

About UsLicensesBlogPromocodes/CouponsBest Website HostingService CenterPartners' Coupon CodesContact UsGift CardMonster's AwardBrand IdentityTop Authors

Support

Help CenterReport SpamSitemapRefund PolicyPrivacy PolicyTerms of UseAI Website Builder Terms of Service

© 2026 TemplateMonster.com. Jetimpex Inc. All rights reserved.

Last time updated 2026-08-16T05:35:35-04:00