• Website Templates
    • Wordpress Store
      • WordPress Templates
      • WooCommerce Themes
      • Marketplace for Elementor
      • WordPress Maintenance
    • HTML Templates
      • HTML5 Site Templates
      • Landing Page Templates
      • Admin Templates
      • Newsletter Template
      • Specialty Pages
      • Muse Templates
    • Website Builders
      • TemplateMonster Sites
    • E-commerce Templates
      • Shopify Themes
      • Magento Themes
      • PrestaShop Themes
      • OpenCart Templates
      • VirtueMart Templates
      • ZenCart Templates
      • BigCommerce Themes
    • CMS Templates
      • Joomla Templates
      • Drupal Themes
    • Kits
      • Elementor Kits
    • Popular Categories
      • Software Company HTML Templates
      • Construction HTML Templates
      • Business Website Templates
      • Travel Website Templates
      • Business Wordpress Themes
      • Web Design Templates
      • Medical Wordpress Themes
      • News & Magazine WordPress Themes
      • Pet Shop Shopify Themes
      • Consulting HTML Templates
      • Consulting WordPress Themes
      • Advertising Agency Templates
      • Jewelry Shopify Themes
      • Software Company WordPress Themes
      • Auto Parts Shopify Themes
    • Website Categories
      • Art & Culture
      • Animals & Pets
      • Design & Photography
      • Education & Books
      • Business & Services
      • Cars & Motorcycles
      • Computers & Internet
      • Electronics Templates
      • Entertainment, Games & Nightlife
      • Home & Family
      • Fashion & Beauty
      • Food & Restaurant
      • Holidays, Gifts & Flowers
      • Medical Templates
      • Real Estate Templates
      • Society & People
      • Sports, Outdoors & Travel
  • WordPress Themes
  • Presentations
    • Presentations types
      • PowerPoint Templates
      • Google Slides Themes
      • Keynote Templates
      • Infographic Elements
    • Popular Categories
      • Design PowerPoint Templates
      • Consulting PowerPoint Templates
      • Web Design PowerPoint Templates
      • Art PowerPoint Templates
      • Business PowerPoint Templates
      • Fitness PowerPoint Templates
      • Design Studio PowerPoint Templates
      • Transportation PowerPoint Templates
      • Education Keynote Templates
      • Fashion Beauty PowerPoint Templates
      • Real Estate Keynote Templates
      • Food PowerPoint Templates
      • Architecture PowerPoint Templates
      • Lawyer PowerPoint Templates
      • Cars PowerPoint Templates
  • Graphics
    • Graphics
      • Illustrations
      • Fonts and Icon Fonts
      • Icon Sets
      • Patterns
      • Vectors
      • Backgrounds
      • Product Mockups
      • Google Sheets
    • Templates
      • Logo Templates
      • PSD Templates
      • Resume Templates
      • Certificate Templates
      • Magazine Templates
      • Planners
      • Corporate Identity
      • T-shirts
    • Web Elements
      • UI Elements
      • Animated Banners
      • Social Media
    • More
      • Unbounce Templates
      • Sketch Templates
      • App Templates
      • Bundles
      • Ebooks
  • Plugins
    • Plugins
      • WordPress Plugins
      • PrestaShop Modules
      • Joomla Extensions
      • Magento Extensions
      • JavaScript
      • Shopify Sections
  • 3D
    • 3D Graphics
      • 3D Models
  • Video
    • Video Templates
      • After Effects Templates
      • Premiere Pro Templates
      • Final Cut Pro Templates
      • Motion Graphics Templates
    • Stock Videos
      • Stock Video
  • Audio
    • Music
      • Stock Music
      • Sound Effects
  • Services
    • All Services
      • Web Design & Dev
      • Website Optimization
      • Graphic Design
      • Ads & Marketing
      • Content Writing
  • Recommended Hosting
  • Hire a Developer
ESES RURU DEDE PLPL ITIT TRTR FRFR BRBR NLNL CNCN CZCZ UAUA HUHU SESE
Log In to AI Builder
Website TemplatesWordPressShopifyHTMLWooCommerce PrestaShopJoomlaPowerPointMaintenance ServiceHire a Developer
Graphics Logo Templates

192 Contractor Logo Templates

Applied filter(s):
Tags: contractor × Clear
Sort by:
Trending Bestsellers Lowest Price Highest Price Top Rated Newest Products

Categories

Graphics Logo Templates

Topics

Education & Books (1) Real Estate Templates (36) Cars & Motorcycles (1) Design & Photography (85) Business & Services (26) Animals & Pets (4) Home & Family (35) Society & People (8) Computers & Internet (2) Sports, Outdoors & Travel (2)

MonsterONE Subscription

AI-generated

Created by Humans (18) Created with AI (3)

Tags

contractor (192) construction (177) architecture (134) logo (121) repair (118) builder (103) renovation (98) handyman (95) property (94) fix (88)

Color

white (161) grey (90) black (54) green (15) brown (8) pink (7) blue (7) cyan (6) yellow (5) orange (4)

Graphics Type

Vector (112) Raster (38)

Compatibility

Adobe Illustrator (112) Adobe Photoshop (44) Corel Draw (5) Figma (1)

Files Included

EPS (104) AI (62) JPG (57) PSD (44) PNG (43) JPEG (39) PDF (5) SVG (4) TXT (1)

Updated (in last 6 months)

Real estate Shingles Roofing 29 Logo Template

Real estate Shingles Roofing 29 Logo Template

$23
Pixel Build Logo Template

Pixel Build Logo Template

$25
Build a Website in Minutes AI Website Builder
  • WordPress Management
  • Ecommerce Ready
  • Free Domain & Premium Hosting
  • Free SSL & Advanced Security
  • SEO Optimized & 90+ PageSpeed Score
  • Fully Responsive & Mobile-Ready
Start building
Home Repair Logo Template

Home Repair Logo Template

$25
Real estate Green Roofing 55 Logo Template

Real estate Green Roofing 55 Logo Template

$23
Real estate Green Roofing 30 Logo Template

Real estate Green Roofing 30 Logo Template

$23
Real Estate Metal Roofing 15 Logo Template

Real Estate Metal Roofing 15 Logo Template

$23
Real Estate Metal Roofing 17 Logo Template

Real Estate Metal Roofing 17 Logo Template

$23
Real Estate Metal Roofing 21 Logo Template

Real Estate Metal Roofing 21 Logo Template

$23
Real Estate Metal Roofing 2 Logo Template

Real Estate Metal Roofing 2 Logo Template

$23
Point Repair Logo Template

Point Repair Logo Template

$19
Home Repair abstrac Logo Template

Home Repair abstrac Logo Template

$19
Home Renovation Logo Template Vector File

Home Renovation Logo Template Vector File

$11
Letter R House Re Level Construction Logo Design

Letter R House Re Level Construction Logo Design

$99
Letter C Hexagon Construction Logo

Letter C Hexagon Construction Logo

$12
Pro Nature Home Logo Temp

Pro Nature Home Logo Temp

$29
Home  Repair Logo Template

Home Repair Logo Template

$19
Worker Helmet Building Construction Logo Design

Worker Helmet Building Construction Logo Design

$99
Home Real Estate Pro Logo

Home Real Estate Pro Logo

$29
Pixel Real Estate Pro Logo Template

Pixel Real Estate Pro Logo Template

$31
Tiny House Pro Logo Template

Tiny House Pro Logo Template

$29
Alliance Real Estate Pro Logo Template

Alliance Real Estate Pro Logo Template

$34
Pixel Work Help Support Logo

Pixel Work Help Support Logo

$31
Homedeco Decor Logo Templates

Homedeco Decor Logo Templates

$27
Expert House Home Care Logo Design

Expert House Home Care Logo Design

$99
Expert Construction Home House Repair Remodeling Logo Design

Expert Construction Home House Repair Remodeling Logo Design

$99
Real Estate Custom Design Logo 7

Real Estate Custom Design Logo 7

$20
WE Workaround Estate  Letter Logo Template

WE Workaround Estate Letter Logo Template

$25
Modern Skyhook Logo Template

Modern Skyhook Logo Template

$13
Check Cube Logo template

Check Cube Logo template

$25
Building Engineer Handyman House Contractor Construction Logo Design

Building Engineer Handyman House Contractor Construction Logo Design

$99
Home House Repair Build Handyman Logo Design

Home House Repair Build Handyman Logo Design

$99
West Model Real Estate Logo template

West Model Real Estate Logo template

$25
Home Seller Logo template

Home Seller Logo template

$25
Search Home Logo template

Search Home Logo template

$25
Urban City Logo template

Urban City Logo template

$25
Ready-to-Use Construction Logo Template

Ready-to-Use Construction Logo Template

$16
  • «
  • 1
  • 2
  • 3
  • 4
  • 5
  • 6
  • »

5 Best Contractor Logo Templates 2026

Template Name Downloads Price
Real estate Shingles Roofing 29 Logo Template 0 $23
Pixel Build Logo Template 0 $25
Home Repair Logo Template 0 $25
Real estate Green Roofing 55 Logo Template 0 $23
Real estate Green Roofing 30 Logo Template 0 $23

Popular tags:

businessstudioheadhospitalprintcomposebrainstormdropsupplementshutterbalancedepthsprayfinancesmarketplaceniceplanbottleevillow

TemplateMonster is a marketplace where you can buy everything you need to create a website. Hundreds of independent developers sell their products here so that you could create your own unique project.

InstagramFacebookYouTubeTwitterPinterestTikTok

Products

WordPress ThemesWooCommerce ThemesHTML5 TemplatesShopify ThemesZemezMotoCMSWebliumMotoPressMonsterONENovi Builder

Topics

Business & ServicesFashion & BeautyHome & FamilyDesign & PhotographyReal EstateCars & MotorcyclesMedicalSports, Outdoors & TravelFood & RestaurantElectronics

Company

About UsLicensesBlogPromocodes/CouponsBest Website HostingService CenterPartners' Coupon CodesContact UsGift CardMonster's AwardBrand IdentityTop Authors

Support

Help CenterReport SpamSitemapRefund PolicyPrivacy PolicyTerms of UseAI Website Builder Terms of Service

© 2026 TemplateMonster.com. Jetimpex Inc. All rights reserved.

Last time updated 2026-08-07T06:21:29-04:00