• Website Templates
    • Wordpress Store
      • WordPress Templates
      • WooCommerce Themes
      • Marketplace for Elementor
      • WordPress Maintenance
    • HTML Templates
      • HTML5 Site Templates
      • Landing Page Templates
      • Admin Templates
      • Newsletter Template
      • Specialty Pages
      • Muse Templates
    • Website Builders
      • TemplateMonster Sites
    • E-commerce Templates
      • Shopify Themes
      • Magento Themes
      • PrestaShop Themes
      • OpenCart Templates
      • VirtueMart Templates
      • ZenCart Templates
      • BigCommerce Themes
    • CMS Templates
      • Joomla Templates
      • Drupal Themes
    • Kits
      • Elementor Kits
    • Popular Categories
      • Software Company HTML Templates
      • Construction HTML Templates
      • Business Website Templates
      • Travel Website Templates
      • Business Wordpress Themes
      • Web Design Templates
      • Medical Wordpress Themes
      • News & Magazine WordPress Themes
      • Pet Shop Shopify Themes
      • Consulting HTML Templates
      • Consulting WordPress Themes
      • Advertising Agency Templates
      • Jewelry Shopify Themes
      • Software Company WordPress Themes
      • Auto Parts Shopify Themes
    • Website Categories
      • Art & Culture
      • Animals & Pets
      • Design & Photography
      • Education & Books
      • Business & Services
      • Cars & Motorcycles
      • Computers & Internet
      • Electronics Templates
      • Entertainment, Games & Nightlife
      • Home & Family
      • Fashion & Beauty
      • Food & Restaurant
      • Holidays, Gifts & Flowers
      • Medical Templates
      • Real Estate Templates
      • Society & People
      • Sports, Outdoors & Travel
  • WordPress Themes
  • Presentations
    • Presentations types
      • PowerPoint Templates
      • Google Slides Themes
      • Keynote Templates
      • Infographic Elements
    • Popular Categories
      • Design PowerPoint Templates
      • Consulting PowerPoint Templates
      • Web Design PowerPoint Templates
      • Art PowerPoint Templates
      • Business PowerPoint Templates
      • Fitness PowerPoint Templates
      • Design Studio PowerPoint Templates
      • Transportation PowerPoint Templates
      • Education Keynote Templates
      • Fashion Beauty PowerPoint Templates
      • Real Estate Keynote Templates
      • Food PowerPoint Templates
      • Architecture PowerPoint Templates
      • Lawyer PowerPoint Templates
      • Cars PowerPoint Templates
  • Graphics
    • Graphics
      • Illustrations
      • Fonts and Icon Fonts
      • Icon Sets
      • Patterns
      • Vectors
      • Backgrounds
      • Product Mockups
      • Google Sheets
    • Templates
      • Logo Templates
      • PSD Templates
      • Resume Templates
      • Certificate Templates
      • Magazine Templates
      • Planners
      • Corporate Identity
      • T-shirts
    • Web Elements
      • UI Elements
      • Animated Banners
      • Social Media
    • More
      • Unbounce Templates
      • Sketch Templates
      • App Templates
      • Bundles
      • Ebooks
  • Plugins
    • Plugins
      • WordPress Plugins
      • PrestaShop Modules
      • Joomla Extensions
      • Magento Extensions
      • JavaScript
      • Shopify Sections
  • 3D
    • 3D Graphics
      • 3D Models
  • Video
    • Video Templates
      • After Effects Templates
      • Premiere Pro Templates
      • Final Cut Pro Templates
      • Motion Graphics Templates
    • Stock Videos
      • Stock Video
  • Audio
    • Music
      • Stock Music
      • Sound Effects
  • Services
    • All Services
      • Web Design & Dev
      • Website Optimization
      • Graphic Design
      • Ads & Marketing
      • Content Writing
  • Recommended Hosting
  • Hire a Developer
ESES RURU DEDE PLPL ITIT TRTR FRFR BRBR NLNL CNCN CZCZ UAUA HUHU SESE
AI Website Builder
Website TemplatesWordPressShopifyHTMLWooCommerce PrestaShopJoomlaPowerPointMaintenance ServiceHire a Developer
Website Templates OpenCart Templates

12 Tea OpenCart Templates

Applied filter(s):
Tags: tea × Clear
Sort by:
Trending Bestsellers Lowest Price Highest Price Top Rated Newest Products

Categories

Website Templates OpenCart Templates

Topics

Medical Templates (1) Design & Photography (2) Home & Family (2) Fashion & Beauty (1) Food & Restaurant (9) Entertainment, Games & Nightlife (1)

MonsterONE Subscription

Tags

tea (12) organic (8) shop (8) cafe (7) food (7) store (7) opencart (7) bakery (6) coffee (6) accessories (5)

Color

white (12) black (9) brown (5) grey (4) green (3) purple (1)

Features

Online Store/Shop (12) Responsive (12) Bootstrap (11) Admin Panel (10) HTML plus JS (9) Dropdown Menu (8) HTML 5 (8) JQuery (8) Blog (7) Parallax (6)

Currencies

USD (7) GBP (7) EUR (7)

Gallery Script (Slider)

Language support

Russian (12) German (12) English (12) Deutsch (3) Japanese (3) Swedish (3) Italian (3) Dutch (3) Ukrainian (3) Portuguese (Brazilian) (3)

OpenCart Modules

Bestsellers (7) Category (7) Featured (7) Latest (7) Specials (7) Account (6) Banner (6) Carousel (5) Affiliate (4) Store (4)

OpenCart Compatibility

4.1.0.x (1) 4.0.2.3 (1) 4.0.2.2 (1) 3.0.4.0 (2) 3.0.3.9 (3) 3.0.3.8 (3) 3.0.3.7 (3) 3.0.3.6 (3) 3.0.3.5 (3) 3.0.3.3 (2)

Styles

Neutral (9) Flat (5) Clean (2) Minimalist (2) Dark (2) Futurist (2) Mobile (2) Retro (1) Web2.0 (1)
Zivero - Organic & Beauty OpenCart 4 Template

Zivero - Organic & Beauty OpenCart 4 Template

$56
Hotbeans - Coffee Store OpenCart Responsive Template

Hotbeans - Coffee Store OpenCart Responsive Template

$39
Build a Website in Minutes AI Website Builder
  • WordPress Management
  • Ecommerce Ready
  • Free Domain & Premium Hosting
  • Free SSL & Advanced Security
  • SEO Optimized & 90+ PageSpeed Score
  • Fully Responsive & Mobile-Ready
Start building
Teahouse - Food and Drinks Store OpenCart Template

Teahouse - Food and Drinks Store OpenCart Template

$39
Brew Shop.com - Efficient Alcohol Online Shop OpenCart Template

Brew Shop.com - Efficient Alcohol Online Shop OpenCart Template

$80
Foodelma - Delicious Food Online Store OpenCart Template

Foodelma - Delicious Food Online Store OpenCart Template

$80
Wine Store Responsive OpenCart Template

Wine Store Responsive OpenCart Template

$80
Fresh Caviar - Caviar Shop OpenCart Template

Fresh Caviar - Caviar Shop OpenCart Template

$80
Kitchen Supplies OpenCart Template

Kitchen Supplies OpenCart Template

$75
Tea Time OpenCart Template

Tea Time OpenCart Template

$70
Asian Grocery Store OpenCart Template

Asian Grocery Store OpenCart Template

$56
Decorative Candles OpenCart Template

Decorative Candles OpenCart Template

$56
Kitchen Supplies Store OpenCart Template

Kitchen Supplies Store OpenCart Template

$70

5 Best Tea OpenCart Templates 2026

Template Name Downloads Price
Zivero - Organic & Beauty OpenCart 4 Template 59 $56
Hotbeans - Coffee Store OpenCart Responsive Template 2 $39
Teahouse - Food and Drinks Store OpenCart Template 7 $39
Brew Shop.com - Efficient Alcohol Online Shop OpenCart Template 4 $80
Foodelma - Delicious Food Online Store OpenCart Template 3 $80

Popular tags:

productshealthhtmlorganicopencartmultilanguageclothinteriorjewelleryt shirtplasticbodyvitaminstemplateshandicraftyachtcardspulloverupluxury

TemplateMonster is a marketplace where you can buy everything you need to create a website. Hundreds of independent developers sell their products here so that you could create your own unique project.

InstagramFacebookYouTubeTwitterPinterestTikTok

Products

WordPress ThemesWooCommerce ThemesHTML5 TemplatesShopify ThemesZemezMotoCMSWebliumMotoPressMonsterONENovi Builder

Topics

Business & ServicesFashion & BeautyHome & FamilyDesign & PhotographyReal EstateCars & MotorcyclesMedicalSports, Outdoors & TravelFood & RestaurantElectronics

Company

About UsLicensesBlogPromocodes/CouponsBest Website HostingService CenterPartners' Coupon CodesContact UsGift CardMonster's AwardBrand IdentityTop Authors

Support

Help CenterReport SpamSitemapRefund PolicyPrivacy PolicyTerms of UseAI Website Builder Terms of Service

© 2026 TemplateMonster.com. Jetimpex Inc. All rights reserved.

Last time updated 2026-07-22T10:00:42-04:00