• Website Templates
    • Wordpress Store
      • WordPress Templates
      • WooCommerce Themes
      • Marketplace for Elementor
      • WordPress Maintenance
    • HTML Templates
      • HTML5 Site Templates
      • Landing Page Templates
      • Admin Templates
      • Newsletter Template
      • Specialty Pages
      • Muse Templates
    • Website Builders
      • TemplateMonster Sites
    • E-commerce Templates
      • Shopify Themes
      • Magento Themes
      • PrestaShop Themes
      • OpenCart Templates
      • VirtueMart Templates
      • ZenCart Templates
      • BigCommerce Themes
    • CMS Templates
      • Joomla Templates
      • Drupal Themes
    • Kits
      • Elementor Kits
    • Popular Categories
      • Software Company HTML Templates
      • Construction HTML Templates
      • Business Website Templates
      • Travel Website Templates
      • Business Wordpress Themes
      • Web Design Templates
      • Medical Wordpress Themes
      • News & Magazine WordPress Themes
      • Pet Shop Shopify Themes
      • Consulting HTML Templates
      • Consulting WordPress Themes
      • Advertising Agency Templates
      • Jewelry Shopify Themes
      • Software Company WordPress Themes
      • Auto Parts Shopify Themes
    • Website Categories
      • Art & Culture
      • Animals & Pets
      • Design & Photography
      • Education & Books
      • Business & Services
      • Cars & Motorcycles
      • Computers & Internet
      • Electronics Templates
      • Entertainment, Games & Nightlife
      • Home & Family
      • Fashion & Beauty
      • Food & Restaurant
      • Holidays, Gifts & Flowers
      • Medical Templates
      • Real Estate Templates
      • Society & People
      • Sports, Outdoors & Travel
  • WordPress Themes
  • Presentations
    • Presentations types
      • PowerPoint Templates
      • Google Slides Themes
      • Keynote Templates
      • Infographic Elements
    • Popular Categories
      • Design PowerPoint Templates
      • Consulting PowerPoint Templates
      • Web Design PowerPoint Templates
      • Art PowerPoint Templates
      • Business PowerPoint Templates
      • Fitness PowerPoint Templates
      • Design Studio PowerPoint Templates
      • Transportation PowerPoint Templates
      • Education Keynote Templates
      • Fashion Beauty PowerPoint Templates
      • Real Estate Keynote Templates
      • Food PowerPoint Templates
      • Architecture PowerPoint Templates
      • Lawyer PowerPoint Templates
      • Cars PowerPoint Templates
  • Graphics
    • Graphics
      • Illustrations
      • Fonts and Icon Fonts
      • Icon Sets
      • Patterns
      • Vectors
      • Backgrounds
      • Product Mockups
      • Google Sheets
    • Templates
      • Logo Templates
      • PSD Templates
      • Resume Templates
      • Certificate Templates
      • Magazine Templates
      • Planners
      • Corporate Identity
      • T-shirts
    • Web Elements
      • UI Elements
      • Animated Banners
      • Social Media
    • More
      • Unbounce Templates
      • Sketch Templates
      • App Templates
      • Bundles
      • Ebooks
  • Plugins
    • Plugins
      • WordPress Plugins
      • PrestaShop Modules
      • Joomla Extensions
      • Magento Extensions
      • JavaScript
      • Shopify Sections
  • 3D
    • 3D Graphics
      • 3D Models
  • Video
    • Video Templates
      • After Effects Templates
      • Premiere Pro Templates
      • Final Cut Pro Templates
      • Motion Graphics Templates
    • Stock Videos
      • Stock Video
  • Audio
    • Music
      • Stock Music
      • Sound Effects
  • Services
    • All Services
      • Web Design & Dev
      • Website Optimization
      • Graphic Design
      • Ads & Marketing
      • Content Writing
  • Recommended Hosting
  • Hire a Developer
ESES RURU DEDE PLPL ITIT TRTR FRFR BRBR NLNL CNCN CZCZ UAUA HUHU SESE
Log In to AI Builder
Website TemplatesWordPressShopifyHTMLWooCommerce PrestaShopJoomlaPowerPointMaintenance ServiceHire a Developer
Graphics PSD Templates

21 Studio PSD Templates

Applied filter(s):
Tags: studio × Clear
Sort by:
Trending Bestsellers Lowest Price Highest Price Top Rated Newest Products

Categories

Graphics PSD Templates

Topics

Education & Books (2) Design & Photography (7) Business & Services (4) Home & Family (2) Fashion & Beauty (5) Society & People (1) Computers & Internet (1)

MonsterONE Subscription

Tags

studio (21) psd (13) creative (11) portfolio (11) template (11) photoshop (10) theme (9) agency (8) modern (8) photography (7)

Color

white (18) black (17) grey (15) brown (6) green (6) blue (3) purple (2) pink (2) cyan (2) orange (1)
Asiku - Personal PSD Template

Asiku - Personal PSD Template

$11
Aloxa Online Store  Store PSD Template

Aloxa Online Store Store PSD Template

$9
Build a Website in Minutes AI Website Builder
  • WordPress Management
  • Ecommerce Ready
  • Free Domain & Premium Hosting
  • Free SSL & Advanced Security
  • SEO Optimized & 90+ PageSpeed Score
  • Fully Responsive & Mobile-Ready
Start building
PIWAY - Music School PSD Template

PIWAY - Music School PSD Template

$13
Lenze - Photography Studio PSD Template

Lenze - Photography Studio PSD Template

$11
Dotwork - Tattoo Studio PSD Template

Dotwork - Tattoo Studio PSD Template

$11
Norman PSD Template

Norman PSD Template

$15
Hi Creative PSD Template

Hi Creative PSD Template

$13
Siam Photography - Photography Studio PSD Template

Siam Photography - Photography Studio PSD Template

$11
Cinerama - Audio Mix Studio PSD Template

Cinerama - Audio Mix Studio PSD Template

$11
WD Photography - Wedding PSD Template

WD Photography - Wedding PSD Template

$11
Photography Studio - Photography PSD Template

Photography Studio - Photography PSD Template

$11
Yoga Wellness Centre PSD Template

Yoga Wellness Centre PSD Template

$11
Clemo - Multipurpose PSD Template

Clemo - Multipurpose PSD Template

$15
Oxy Creative PSD Template

Oxy Creative PSD Template

$15
Inked PSD Template

Inked PSD Template

$11
diNK - Multipurpose Directory PSD Template

diNK - Multipurpose Directory PSD Template

$15
SpecialMoments - Multipurpose Wedding Photography PSD Template

SpecialMoments - Multipurpose Wedding Photography PSD Template

$11
CONS - Corporate, Consulting and Business PSD Template

CONS - Corporate, Consulting and Business PSD Template

$13
Reflex - Corporate Business and Agency PSD Template

Reflex - Corporate Business and Agency PSD Template

$15
Photography Flyer PSD Template

Photography Flyer PSD Template

$11
Umber | Photography PSD  Template

Umber | Photography PSD Template

$14

5 Best Studio PSD Templates 2026

Template Name Downloads Price
Asiku - Personal PSD Template 0 $11
Aloxa Online Store Store PSD Template 0 $9
PIWAY - Music School PSD Template 1 $13
Lenze - Photography Studio PSD Template 1 $11
Dotwork - Tattoo Studio PSD Template 2 $11

Popular tags:

creativecleanphotoshopmodernagencyservicemarketinglandingwebsiteminimalhomeapphotelbuildinginteriorclothingmealsocialconsultantfreelancer

TemplateMonster is a marketplace where you can buy everything you need to create a website. Hundreds of independent developers sell their products here so that you could create your own unique project.

InstagramFacebookYouTubeTwitterPinterestTikTok

Products

WordPress ThemesWooCommerce ThemesHTML5 TemplatesShopify ThemesZemezMotoCMSWebliumMotoPressMonsterONENovi Builder

Topics

Business & ServicesFashion & BeautyHome & FamilyDesign & PhotographyReal EstateCars & MotorcyclesMedicalSports, Outdoors & TravelFood & RestaurantElectronics

Company

About UsLicensesBlogPromocodes/CouponsBest Website HostingService CenterPartners' Coupon CodesContact UsGift CardMonster's AwardBrand IdentityTop Authors

Support

Help CenterReport SpamSitemapRefund PolicyPrivacy PolicyTerms of UseAI Website Builder Terms of Service

© 2026 TemplateMonster.com. Jetimpex Inc. All rights reserved.

Last time updated 2026-08-16T05:51:36-04:00