• Website Templates
    • Wordpress Store
      • WordPress Templates
      • WooCommerce Themes
      • Marketplace for Elementor
      • WordPress Maintenance
    • HTML Templates
      • HTML5 Site Templates
      • Landing Page Templates
      • Admin Templates
      • Newsletter Template
      • Specialty Pages
      • Muse Templates
    • Website Builders
      • TemplateMonster Sites
    • E-commerce Templates
      • Shopify Themes
      • Magento Themes
      • PrestaShop Themes
      • OpenCart Templates
      • VirtueMart Templates
      • ZenCart Templates
      • BigCommerce Themes
    • CMS Templates
      • Joomla Templates
      • Drupal Themes
    • Kits
      • Elementor Kits
    • Popular Categories
      • Software Company HTML Templates
      • Construction HTML Templates
      • Business Website Templates
      • Travel Website Templates
      • Business Wordpress Themes
      • Web Design Templates
      • Medical Wordpress Themes
      • News & Magazine WordPress Themes
      • Pet Shop Shopify Themes
      • Consulting HTML Templates
      • Consulting WordPress Themes
      • Advertising Agency Templates
      • Jewelry Shopify Themes
      • Software Company WordPress Themes
      • Auto Parts Shopify Themes
    • Website Categories
      • Art & Culture
      • Animals & Pets
      • Design & Photography
      • Education & Books
      • Business & Services
      • Cars & Motorcycles
      • Computers & Internet
      • Electronics Templates
      • Entertainment, Games & Nightlife
      • Home & Family
      • Fashion & Beauty
      • Food & Restaurant
      • Holidays, Gifts & Flowers
      • Medical Templates
      • Real Estate Templates
      • Society & People
      • Sports, Outdoors & Travel
  • WordPress Themes
  • Presentations
    • Presentations types
      • PowerPoint Templates
      • Google Slides Themes
      • Keynote Templates
      • Infographic Elements
    • Popular Categories
      • Design PowerPoint Templates
      • Consulting PowerPoint Templates
      • Web Design PowerPoint Templates
      • Art PowerPoint Templates
      • Business PowerPoint Templates
      • Fitness PowerPoint Templates
      • Design Studio PowerPoint Templates
      • Transportation PowerPoint Templates
      • Education Keynote Templates
      • Fashion Beauty PowerPoint Templates
      • Real Estate Keynote Templates
      • Food PowerPoint Templates
      • Architecture PowerPoint Templates
      • Lawyer PowerPoint Templates
      • Cars PowerPoint Templates
  • Graphics
    • Graphics
      • Illustrations
      • Fonts and Icon Fonts
      • Icon Sets
      • Patterns
      • Vectors
      • Backgrounds
      • Product Mockups
      • Google Sheets
    • Templates
      • Logo Templates
      • PSD Templates
      • Resume Templates
      • Certificate Templates
      • Magazine Templates
      • Planners
      • Corporate Identity
      • T-shirts
    • Web Elements
      • UI Elements
      • Animated Banners
      • Social Media
    • More
      • Unbounce Templates
      • Sketch Templates
      • App Templates
      • Bundles
      • Ebooks
  • Plugins
    • Plugins
      • WordPress Plugins
      • PrestaShop Modules
      • Joomla Extensions
      • Magento Extensions
      • JavaScript
      • Shopify Sections
  • 3D
    • 3D Graphics
      • 3D Models
  • Video
    • Video Templates
      • After Effects Templates
      • Premiere Pro Templates
      • Final Cut Pro Templates
      • Motion Graphics Templates
    • Stock Videos
      • Stock Video
  • Audio
    • Music
      • Stock Music
      • Sound Effects
  • Services
    • All Services
      • Web Design & Dev
      • Website Optimization
      • Graphic Design
      • Ads & Marketing
      • Content Writing
  • Recommended Hosting
  • Hire a Developer
ESES RURU DEDE PLPL ITIT TRTR FRFR BRBR NLNL CNCN CZCZ UAUA HUHU SESE
AI Website Builder
Website TemplatesWordPressShopifyHTMLWooCommerce PrestaShopJoomlaPowerPointMaintenance ServiceHire a Developer
Website Templates WooCommerce Themes

56 Digital WooCommerce Themes

Applied filter(s):
Tags: digital × Clear
Sort by:
Trending Bestsellers Lowest Price Highest Price Top Rated Newest Products

Categories

Website Templates WooCommerce Themes

Topics

Real Estate Templates (3) Design & Photography (12) Business & Services (13) Art & Culture (4) Electronics Templates (40) Home & Family (15) Fashion & Beauty (11) Holidays, Gifts & Flowers (2) Computers & Internet (29) Food & Restaurant (4) Sports, Outdoors & Travel (8) Entertainment, Games & Nightlife (15)

On Sale (Yes)

MonsterONE Subscription

Tags

digital (56) electronics (47) woocommerce (45) multipurpose (39) accessories (37) electronic (34) responsive (34) wordpress (34) ecommerce (34) gadgets (33)

WordPress Builder

Elementor Website Builder (54) Gutenberg Editor (1) WPBakery Page Builder (1) Custom (1)

Color

white (35) black (28) grey (23) blue (5) orange (5) purple (4) brown (3) cyan (3) yellow (3) red (2)

Features

Responsive (55) Sample content (54) Blog (54) Advanced Theme Options (53) Dropdown Menu (51) eCommerce (51) Drag and Drop Content (50) Admin Panel (50) Search Engine Friendly (50) Online Store/Shop (49)

WordPress Compatibility

7.0.x (8) 6.9.x (29) 6.8.x (37) 6.7.x (50) 6.6.x (52) 6.5.x (54) 6.4.x (55) 6.3.x (54) 6.2.x (53) 6.1.x (51)

WooCommerce Compatibility

9.9.x (31) 9.8.x (37) 9.7.x (48) 9.6.x (49) 9.5.x (49) 9.4.x (49) 9.3.x (49) 9.2.x (49) 9.1.x (50) 9.0.x (50)

Compatible with

WooCommerce (55) MailChimp (53) WPML (50) Polylang (45) Revolution Slider (42) LearnPress (3)

WordPress.com Compatibility (WordPress.com Business Plan)

Styles

Clean (46) Minimalist (40) Neutral (38) Mobile (38) Flat (37) Futurist (34) Corporate (27) Collage (27) Web2.0 (24) Dark (22)

Updated (in last 6 months)

Electshop - Multipurpose Electronics Store Elementor WooCommerce Responsive Theme

Electshop - Multipurpose Electronics Store Elementor WooCommerce Responsive Theme

$71
Ellomart - Electronics and Digital Store Elementor WooCommerce Responsive Theme

Ellomart - Electronics and Digital Store Elementor WooCommerce Responsive Theme

$71
Build a Website in Minutes AI Website Builder
  • WordPress Management
  • Ecommerce Ready
  • Free Domain & Premium Hosting
  • Free SSL & Advanced Security
  • SEO Optimized & 90+ PageSpeed Score
  • Fully Responsive & Mobile-Ready
Start building
Lightness - Lighting and Home Decor Store Elementor WooCommerce Responsive Theme

Lightness - Lighting and Home Decor Store Elementor WooCommerce Responsive Theme

$71
Elobyte - Electronics & Digital Mega Store Elementor WooCommerce Responsive Theme

Elobyte - Electronics & Digital Mega Store Elementor WooCommerce Responsive Theme

$71
Print Hive – Printing Products & Design WooCommerce WordPress Theme

Print Hive – Printing Products & Design WooCommerce WordPress Theme

$35
Kitchenware - Kitchen, Home Appliances and Crockery Multipurpose Responsive WooCommerce Theme

Kitchenware - Kitchen, Home Appliances and Crockery Multipurpose Responsive WooCommerce Theme

$69
Film Fluent - Movie Studio & Film Maker WooCommerce Elementor Template

Film Fluent - Movie Studio & Film Maker WooCommerce Elementor Template

$50
Game Freak – Gaming Devices & Accessories WooCommerce Elementor Template SALE

Game Freak – Gaming Devices & Accessories WooCommerce Elementor Template

$50
$40
ElecKart - Electronics, Mobiles and Computers Store Elementor WooCommerce Theme

ElecKart - Electronics, Mobiles and Computers Store Elementor WooCommerce Theme

$71
Digitazz - Digital and Electronics Store Elementor Woocommerce Theme

Digitazz - Digital and Electronics Store Elementor Woocommerce Theme

$71
Electvol - Electronic and Tech Gadgets WooCommerce Theme

Electvol - Electronic and Tech Gadgets WooCommerce Theme

$71
Gadgetic - Electronics, Gadget and Technology Store Elementor WooCommerce Responsive Theme

Gadgetic - Electronics, Gadget and Technology Store Elementor WooCommerce Responsive Theme

$71
eGadget - Electronic & Gadget Store Elementor WooCommerce Responsive Theme

eGadget - Electronic & Gadget Store Elementor WooCommerce Responsive Theme

$71
Dronaby - Drones, CCTV and Single Product WooCommerce WordPress Theme

Dronaby - Drones, CCTV and Single Product WooCommerce WordPress Theme

$69
Electhub - Smart Electronic Gadgets Store Elementor WooCommerce Responsive Theme

Electhub - Smart Electronic Gadgets Store Elementor WooCommerce Responsive Theme

$71
Sizuka - Luxurious Watch Store Elementor WooCommerce Responsive Theme

Sizuka - Luxurious Watch Store Elementor WooCommerce Responsive Theme

$71
Technozy - Electronics Gadget Store Elementor WooCommerce Responsive Theme

Technozy - Electronics Gadget Store Elementor WooCommerce Responsive Theme

$71
Megastep - Multipurpose Elementor WooCommerce Responsive Theme

Megastep - Multipurpose Elementor WooCommerce Responsive Theme

$71
Bigsoho - Multipurpose Premium Elementor WooCommerce Responsive Theme

Bigsoho - Multipurpose Premium Elementor WooCommerce Responsive Theme

$71
Elecbord - Mega Electronics Store Elementor WooCommerce Responsive Theme

Elecbord - Mega Electronics Store Elementor WooCommerce Responsive Theme

$71
Elocart - Multipurpose Electronics Store Elementor WooCommerce Responsive Theme

Elocart - Multipurpose Electronics Store Elementor WooCommerce Responsive Theme

$71
Intron - Mega Electronics Store Elementor WooCommerce Responsive Theme

Intron - Mega Electronics Store Elementor WooCommerce Responsive Theme

$71
Portable - Megashop Elementor WooCommerce Responsive Theme

Portable - Megashop Elementor WooCommerce Responsive Theme

$71
Gamezi - Gaming and eSports Store WooCommerce theme

Gamezi - Gaming and eSports Store WooCommerce theme

$69
GameStock - Game Store WooCommerce WordPress Theme

GameStock - Game Store WooCommerce WordPress Theme

$32
Storaxia - Multipurpose WooCommerce Theme

Storaxia - Multipurpose WooCommerce Theme

$51
CakeShop – Responsive WooCommerce Theme

CakeShop – Responsive WooCommerce Theme

$32
Techflux - Electronics and Gadgets Multipurpose Responsive WooCommerce Theme

Techflux - Electronics and Gadgets Multipurpose Responsive WooCommerce Theme

$69
Technolic - Electronics, Gadgets and Technology Multipurpose WooCommerce Elementor Theme

Technolic - Electronics, Gadgets and Technology Multipurpose WooCommerce Elementor Theme

$69
iTech - Electronics, Gadgets and Technology Multipurpose WooCommerce Responsive Elementor Theme

iTech - Electronics, Gadgets and Technology Multipurpose WooCommerce Responsive Elementor Theme

$69
Flashy - Game Store and eSports Responsive Elementor WooCommerce Theme

Flashy - Game Store and eSports Responsive Elementor WooCommerce Theme

$69
Gamey - Online Game Elementor WooCommerce Theme

Gamey - Online Game Elementor WooCommerce Theme

$69
Emetix - Electronics Store and Digital Gadgets Shop WooCommerce Theme

Emetix - Electronics Store and Digital Gadgets Shop WooCommerce Theme

$79
Etechno - Electronics and Computers Multipurpose WooCommerce Theme

Etechno - Electronics and Computers Multipurpose WooCommerce Theme

$79
Damon -  Mega Store and Multipurpose WooCommerce Theme

Damon - Mega Store and Multipurpose WooCommerce Theme

$69
Addiction - Fashion, Furniture, Lighting and Multipurpose WooCommerce Theme

Addiction - Fashion, Furniture, Lighting and Multipurpose WooCommerce Theme

$69
  • «
  • 1
  • 2
  • »

5 Best Digital WooCommerce Themes 2026

Template Name Downloads Price
Electshop - Multipurpose Electronics Store Elementor WooCommerce Responsive Theme 24 $71
Ellomart - Electronics and Digital Store Elementor WooCommerce Responsive Theme 13 $71
Lightness - Lighting and Home Decor Store Elementor WooCommerce Responsive Theme 12 $71
Elobyte - Electronics & Digital Mega Store Elementor WooCommerce Responsive Theme 4 $71
Print Hive – Printing Products & Design WooCommerce WordPress Theme 3 $35

Popular tags:

cartclothesmoderncosmeticshopdecorationcleanitemskitchengifteyetemplatescosmeticssocksautofreestandardtieclientsclock

TemplateMonster is a marketplace where you can buy everything you need to create a website. Hundreds of independent developers sell their products here so that you could create your own unique project.

InstagramFacebookYouTubeTwitterPinterestTikTok

Products

WordPress ThemesWooCommerce ThemesHTML5 TemplatesShopify ThemesZemezMotoCMSWebliumMotoPressMonsterONENovi Builder

Topics

Business & ServicesFashion & BeautyHome & FamilyDesign & PhotographyReal EstateCars & MotorcyclesMedicalSports, Outdoors & TravelFood & RestaurantElectronics

Company

About UsLicensesBlogPromocodes/CouponsBest Website HostingService CenterPartners' Coupon CodesContact UsGift CardMonster's AwardBrand IdentityTop Authors

Support

Help CenterReport SpamSitemapRefund PolicyPrivacy PolicyTerms of UseAI Website Builder Terms of Service

© 2026 TemplateMonster.com. Jetimpex Inc. All rights reserved.

Last time updated 2026-07-27T06:08:41-04:00